DPCstruct | MC7596
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 93 ± 10 aa |
| Standard deviation of domain lengths | 10.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00095 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7QHJ4 | 184-272 | YGGGSGASCRAWCKTPQNQAYCCEDSSEPITIPVVKPGSCPPVRPQCPPVRSGYRPPNQCSNDSKCPGYEKCCYDTCLKHHTCKAPG… |
| A0A7L9R3G2 | 5-98 | SLLVLAACLSLAMTTSIRTTEKPCEDYCEIEGQNNQYECCDRNSGWCPTVRPSCLRNSGVIPYCRYDTHCEKHEKCCEDACLGQKVC… |
| A0A343T7I6 | 20-110 | None |
| A0A6A4WMQ7 | 270-351 | None |
| A0A444SC52 | 45-137 | None |
| A0A6A4VQZ2 | 188-272 | None |
| A0A5N5TI62 | 129-256 | None |
| K9LRY6 | 9-110 | None |
| A0A7L9R3M8 | 3-94 | None |
| A0A423T5E2 | 23-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.