DPCstruct | MC7592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 108 ± 10 aa |
| Standard deviation of domain lengths | 9.50 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 67.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 41.12 |
| Pfam Score | 65.00 |
| Assigned Pfam label(s) | CL0167- PF15017 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A423TTY5 | 77-195 | SEQHNGDEDYDEDQTEEISEDYVNAEEGAGDEEEDDDAGGWITLSNVKKHKMKKIGLKPEEEIEEKEVLVACMTADFAMQNVLKHIG… |
| A0A091CRN5 | 182-287 | EEAEGDGSEESEGEGSGDDGGGWITPSNIGQIQRELEKGDVPQDVRVGCVTTDFAMQNVLLQMGLHVLAVDGMLIREARSSILRCHG… |
| A0A3B5LPF0 | 92-197 | None |
| A0A0B1SMA6 | 118-240 | None |
| A0A067G973 | 1-94 | None |
| A0A3Q7RHU6 | 23-131 | None |
| A0A4V3SBN0 | 533-651 | None |
| A0A7S1TA81 | 56-168 | None |
| A0A2G9QDM7 | 1-99 | None |
| A0A7S3A992 | 57-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.