DPCstruct | MC7590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 486 ± 105 aa |
| Standard deviation of domain lengths | 105.02 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 79.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.02 |
| Pfam Score | 98.85 |
| Assigned Pfam label(s) | CL0316- CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R2Y0Y3 | 2-339 | DFIFLIIVFFIISTIVKNSDYQNHNLSVETTTNLQIIAVFFVILHHLSQILKDYPDSFLSSRLIIAGRLAVGLFFFVSGYGMIKQFR… |
| A0A423TLJ1 | 111-597 | SRLVAQGSISDSSDGLHAGVLAVKYDTQILMNLYCNDHLNFDDGTCCNSREAVTMTQIATFAALCSCPIILIAVAVKQWLCVSHHVG… |
| A0A4Q4VIM3 | 171-819 | None |
| A0A3Q0J6S7 | 401-896 | None |
| A0A4U0XX92 | 72-565 | None |
| A0A4Y7KXX8 | 18-322 | None |
| A0A4Q4YVP4 | 15-339 | None |
| A0A7S4A3K0 | 636-1122 | None |
| A0A4R1R0N1 | 209-626 | None |
| A0A161W6R8 | 514-1206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.