DPCstruct | MC759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 70 ± 8 aa |
| Standard deviation of domain lengths | 8.47 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 67.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 55.16 |
| Pfam Score | 97.30 |
| Assigned Pfam label(s) | CL0105- CL0351- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7LI88 | 3-70 | EMSAVCAASAEPPAVTEGSEQKKPLKPCCACPETKKVRDACIIEKGEENCTALIEAHKECMRALGFKI |
| A0A0R3X6R9 | 191-249 | MFDGEKFPVGPDGKPLKPCCACPDTRKARDECIVQRGEENCKDLIEAHLACLRSLGFRI |
| A0A7J8UVR2 | 9-78 | None |
| A0A834TD35 | 9-81 | None |
| A0A5N6PJ07 | 2-73 | None |
| W1NH24 | 26-92 | None |
| A0A182FMI1 | 389-461 | None |
| A0A6V7TFR0 | 1-65 | None |
| Q4MYK4 | 1-77 | None |
| A0A833VRR7 | 63-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.