DPCstruct | MC7588
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 86 ± 15 aa |
| Standard deviation of domain lengths | 14.54 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A097R2B1 | 1-80 | MSQPKKQILMNAFNMNCVGHIHHGMWTHPEDRSTDFNSLNYWLDLAKLLERGLFDGLFIADIVGVYDVYQQGIGLTARES |
| A0A6A6DXE7 | 1-105 | MASTNGSAKQRKQLILNTFATNAPAHLAQGLWRPPSTTPQNKTSDFNKLKFWTDLAQLLDKANLHELFIADFLGPYDFYKGLANVDP… |
| A0A0U1DCP1 | 1-73 | None |
| A0A428UE61 | 419-531 | None |
| H1VZU2 | 1-79 | None |
| A0A2N6IM69 | 1-79 | None |
| A0A2D3VJJ3 | 1-70 | None |
| A0A0D2BQ53 | 2-96 | None |
| A0A7I9ZUG1 | 1-93 | None |
| A0A0D2B0Q7 | 21-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.