DPCstruct | MC7587
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 108 ± 15 aa |
| Standard deviation of domain lengths | 14.83 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J9QYP6 | 9-92 | DLQTFGEALGGKSAAAIVDSGDGERVFMVDGDTFNSFQEAAQRTCDNQFNDCADAANAQGNKGDFTVDDCNTQKSNCQSAQSSA |
| A0A6A6DWH5 | 2-109 | KTSLILLAVTTLALTAPTKRQNNLQTFSGALGGIEATPVEDSGNPDRPFQVKGDTFVNIGAALQRSCDQQFNACANAANGGQADLSV… |
| A0A5C2TER6 | 523-635 | None |
| A0A7D8UTZ4 | 536-617 | None |
| S3CCR6 | 100-194 | None |
| S3CZE9 | 499-618 | None |
| A0A6A6A5K5 | 9-125 | None |
| A0A2V1DN35 | 9-105 | None |
| A0A166BNU8 | 594-711 | None |
| A0A0C2XQB8 | 12-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.