DPCstruct | MC7584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 150 ± 10 aa |
| Standard deviation of domain lengths | 10.29 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2CPV7 | 9-146 | TILGSLRLPHPSDSNLTKEHKNLALSLQKDLQMLQNRDLRELNRPLQSLNTAYDRFKLKELDSWRSVGQRPRPQETLVRPSGLLDAP… |
| G3Y1I9 | 42-193 | SQSKRALAGPYRLFGNLFLPEPPLKLRDKLDELRPYLLELENREKSTEIDHEAISEKLCTFQLAETQLWKDPLPNRCAEHIVRPSGS… |
| A0A2S7Y073 | 2-136 | None |
| A0A0C3DA08 | 28-193 | None |
| A0A2T2NBC7 | 154-310 | None |
| A0A0S7E3I5 | 2-142 | None |
| A0A2T3ZTL4 | 265-419 | None |
| A0A2T4A5K9 | 1-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.