DPCstruct | MC7583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 159 ± 17 aa |
| Standard deviation of domain lengths | 16.97 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K0T0X5 | 105-249 | LLNPVNRRLKLYDEEEGDGDEYLLKTQIDHFYNILEQLIEYQADIAGLNGSKLGNNPRRFLEGWDFEDVAKECPTIYPRVATIGDAG… |
| A0A0B4GGN0 | 928-1104 | LMNASNLDMELYEEDEKDESNASIKYRIRDRVNDLYGTLEKLIDYQRSITGERLKSSPRKDLEGWDFKDIAINNENAIYPCLAKLKT… |
| A0A2J6REM4 | 1-153 | None |
| Q2H4N9 | 205-385 | None |
| A0A6A5KV63 | 449-587 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.