DPCstruct | MC7582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 102 ± 7 aa |
| Standard deviation of domain lengths | 7.36 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 43.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6DSL8 | 1-112 | MYHTREATKRHDKVYALLGMSSDDPSAAGLSPNYTIPRKKLLQQLVEFLLFKEVSVETWEEREIAVIKSKGCILGQVSSVESCSARY… |
| A0A6A6EEA2 | 112-221 | YHTREATKRHDKVYTLLGMSSDDLSAAGLTPNYTVPCKTLLQQLVKSVLCKEVFVGTWDEKEIAIIKSKGSILGQASSVESDSTRYD… |
| G4UU46 | 1-113 | None |
| M7TFR2 | 2-98 | None |
| A0A1L9R7I6 | 265-374 | None |
| A0A0F0I8F6 | 1-104 | None |
| Q2UNW1 | 1-104 | None |
| A0A084B5Y1 | 339-434 | None |
| A0A178DGN9 | 1-89 | None |
| A7EPC3 | 2-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.