DPCstruct | MC7576
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 5.44 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538G594 | 2-65 | DSYDSGGYLVFVWSPSGYTLETRSGDPPPVGAEVEDRERRFRVTKLAPSPLPGDGRACAYLQPL |
| A0A7V8XIE6 | 176-238 | ESHEVTAHVVLLTDSGYRVEDVEGPAPAIGGIVEANGTAHRCVRIMRSPFPADRRPCAVLERL |
| A0A538MWV9 | 431-501 | None |
| A0A538LB60 | 100-165 | None |
| A0A538KWA2 | 377-443 | None |
| A0A538DNQ4 | 105-171 | None |
| A0A538DLQ6 | 99-169 | None |
| A0A7W1AAC6 | 74-141 | None |
| A0A7Y6CTN0 | 229-308 | None |
| A0A7V9JPC7 | 120-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.