DPCstruct | MC7573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 101 ± 13 aa |
| Standard deviation of domain lengths | 13.38 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P2DJF7 | 2-104 | SDIELAITRTKALEALLEQAFNATGKGLHDKVTSVQNRLPQPLVRKIRFVATVRNKIVHESDYKHIDDRDGYIRACDEAEAELRALA… |
| A0A2W4R8B3 | 1-94 | MSNLDIVFGYTKKIEKFLETEFKAEGRGLHTKINSIEYLLPIALIKKVRWIATIRNNMAHTEGFEFDNIDDFKSTCEAVLSELEAIR… |
| A0A0G4HYD2 | 20-122 | None |
| R1DWX2 | 78-178 | None |
| A0A2V2GR27 | 15-92 | None |
| A0A1D8K542 | 1-95 | None |
| X6M3T3 | 4-132 | None |
| A0A1E5BGM2 | 85-167 | None |
| A0A179BQQ8 | 4-110 | None |
| A0A4V5NW02 | 2-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.