DPCstruct | MC7571
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 162 ± 42 aa |
| Standard deviation of domain lengths | 41.98 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 80.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 36.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z3HF87 | 1-96 | MTENEALENAVQAQLVRDIFGNPFQPVVFHSEWLTSTVRALAHGMYESRDFSAMPILADALQDARCEDGAILDHCRDPHGVHVCGCW… |
| A0A6P2D4B7 | 196-361 | AYLSPTSRELIERLQQNEERPDLPNDDELSSLYSHALADALYPDGKSAPEIARLAGMGEAIDLSELQWTDIDFDGPPERYENWRPLI… |
| A0A4V0HZ30 | 1-210 | None |
| A0A4V0I0X3 | 33-232 | None |
| A0A4V0I224 | 98-297 | None |
| A0A4V0I2J5 | 21-126 | None |
| A0A4V0I5E6 | 24-227 | None |
| A0A177PUD2 | 100-193 | None |
| A0A177PZ23 | 1-218 | None |
| A0A6C2YXN6 | 31-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.