DPCstruct | MC757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 168 ± 21 aa |
| Standard deviation of domain lengths | 21.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 59.35 |
| Pfam Score | 86.74 |
| Assigned Pfam label(s) | CL0293- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0VHV9 | 1-121 | MPFITYLSGLLTAQMLSDDQLVSGVEIRCEEKGHCPSTCHLCRRPGKEQLSPPPVLLEISRVVPLYALIQDNGTKEAFRSALMSSYW… |
| A0A6P7L288 | 1-150 | MDCTSQGQCPRSCHLCHMSPRAAQGRQQSEPVLLQITKAAPVYELVSTNETYQALQEAMMSLLWCSGKGDVIDDWCRCDSTAFGTDG… |
| A0A5N5PK29 | 240-411 | None |
| A0A3B3V9X5 | 2-176 | None |
| Q61137 | 916-1087 | None |
| A0A401S3E4 | 9-162 | None |
| A0A2Y9NTS1 | 100-274 | None |
| A0A6Q2X1R7 | 495-713 | None |
| G3HMT4 | 799-973 | None |
| A0A340WJL7 | 1-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.