DPCstruct | MC7568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 5.89 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M7ZZG4 | 2-75 | KAKNIGKTIEKKLNEVGVFTLADLAEITPKVAYKKICENYPNTTIPKCYYLYSLQGALLDLDWRELPENIKSEL |
| A0A2P5Z2K0 | 2-87 | STTKLRNIGPKSAAWLRQVGVRTQQDLEAAGAVGAFVKVKRAGFKPSLNLLYSLEGALSGCHWQELSEARRAQLLAELETATAALP |
| A0A837Q206 | 7-90 | None |
| A0A3D1Q659 | 261-341 | None |
| A0A6N6L0J0 | 66-155 | None |
| A0A1F4LV03 | 2-70 | None |
| A0A850L0R5 | 1-87 | None |
| A0A1H3RBB4 | 2-87 | None |
| A0A2E9TFR7 | 7-94 | None |
| S5J9S8 | 97-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.