DPCstruct | MC7565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 219 ± 22 aa |
| Standard deviation of domain lengths | 21.74 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.42 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF04333- CL0051 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W1DY87 | 5-202 | VDPWEETNRSVFEFNQGLDEAVFEPVARAYKENTPEPVQNRVSDFSSNIGDVGTLGNEIAQFEVINSANTLSRVLINSTIGLFGMFD… |
| A0A366I572 | 66-294 | TAAEPVTPPSAGDAQTVPLTSANDAVSPGTEGSARDPWEGFNRRMHGVNNGIDKYVTRPLAITYEKITPESVQSSVTRFFKNLGEPT… |
| A0A1V5UXU8 | 36-238 | None |
| R7KQ27 | 19-235 | None |
| A0A3E0DRV1 | 64-291 | None |
| A0A3D0ICE1 | 38-279 | None |
| A0A172YB74 | 19-249 | None |
| A0A2P5VL42 | 236-459 | None |
| A0A7X2D226 | 299-541 | None |
| A0A090S5X6 | 53-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.