DPCstruct | MC7564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 515 ± 42 aa |
| Standard deviation of domain lengths | 41.50 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 67.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.33 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF03733- PF01699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077WS18 | 1-536 | METESPRRKLKKRDSTNDNVSEHENQHKNKLRSRKSHQEDDRASLDSREMTLKDRQEQMNKRHPFGLPIWKPALYKKSRSVVRRANR… |
| A0A7R5L6Q4 | 1-496 | MASEAEPTRRRRCCRCCCGQDPPDIPKATDSRRGSLCDRHCSTTINNDLGDLGCHLHRPRGPMATPEECESCTRTTLTAENAVEANK… |
| U7PT80 | 186-762 | None |
| L8GKQ3 | 1-424 | None |
| A0A3B3BQ05 | 37-545 | None |
| A0A1L0D2W3 | 1-486 | None |
| A0A6Q2X0Z1 | 18-544 | None |
| A0A5M9MSE6 | 34-582 | None |
| A0A1E4TJV4 | 21-555 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.