DPCstruct | MC7563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 176 ± 14 aa |
| Standard deviation of domain lengths | 14.33 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 65.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 48.67 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | PF13270- PF09728 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q8CEI3 | 1-182 | MEERKAKRKSPKSFSAHSTQVVNAKKNAIPSSKSTGFSNPTSQSASQRPKLKRVMKEKNKPPGGEGKGAQSTPIQHSFLTDVSDVQE… |
| A0A7R5KUL8 | 2-159 | EERKIKRRSPKSSTSHPAQVANSKKSSVPVSKSTAFSNPAPQPAVQKPKLKRVIKEKAKPPGGEAKGAQAAPIQHSFLTDVSDVQEM… |
| C3ZYV6 | 2-142 | None |
| A0A3B4A9Q9 | 1-186 | None |
| G1RY80 | 97-274 | None |
| A0A0M4EFV7 | 109-295 | None |
| S9YTJ9 | 1-183 | None |
| G1LMK6 | 1-200 | None |
| A0A553QK73 | 41-201 | None |
| A0A6J2VAL9 | 22-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.