DPCstruct | MC7561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 157 ± 19 aa |
| Standard deviation of domain lengths | 18.72 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4V8D6 | 1-145 | MDREHAVAVLRKVIAYCPAMKLNDDSRQAWAEALADANFQDSLDAVAVIGAKPLDPGEQLWIQPGHILAEVRRIRARRLDDFDVATL… |
| A0A4R7IU32 | 1-152 | MTPDEAARLLAACAAFDNRQPSEIAKQAWAAALRDLPLDDDTFEAVARYYSAPATPGETGRRWIEPHHVRTTRTKIRDERLGPTIPA… |
| A0A2W2L120 | 1-161 | None |
| A0A6B3AJ95 | 3-176 | None |
| A0A223S082 | 1-190 | None |
| A0A6G2W1Q9 | 1-150 | None |
| A0A1A5PGI9 | 76-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.