DPCstruct | MC756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 8.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9S5N0 | 2-85 | DNFIQHISMRLRALQLNNCINLTSPKLNRSILIEKCETGFNVYENGVNTKTFKKVLFQELTPLLRVLIKIEFSADPRIKVSTLK |
| A0A0N8VKR9 | 1-93 | MPWIPKKAVEKTVYSSLLKMDNGRLISLKTKKKDRSVTIYKDNNLYKIIEDGFKNESYEIGDEKELKKMLKTLIEIEFPRSHEILVT… |
| A0A1T4W533 | 36-127 | None |
| A0A822Q2Z1 | 3-90 | None |
| A0A7R7Z6D6 | 109-199 | None |
| A0A525CKD8 | 4-77 | None |
| D7ATJ0 | 1-88 | None |
| A0A7K0K1Z9 | 6-76 | None |
| Q6AL08 | 1-101 | None |
| A0A832APS3 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.