DPCstruct | MC7559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 75 ± 4 aa |
| Standard deviation of domain lengths | 4.05 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G7WN62 | 15-89 | LYDLAIPIGMPLSVIQDLVDRFELEPVRRNAKVGLLDGESEEREILVLRGDFDTVKAAERYMFEALDRRLAKWER |
| H1YZ63 | 1-78 | MEDKKTEYFDVLIPPGVPRTIIYDITDRFEVEVVNRRRMMKFANMDGDIRELLAFRCTKDTAEKVQEYMLSELEKFIA |
| A0A842Y755 | 29-108 | None |
| A0A7C2ZTL3 | 1-75 | None |
| A0A850LQA0 | 3-80 | None |
| A0A1F2P3Z7 | 3-75 | None |
| A0A7L4PL33 | 15-84 | None |
| Q0W328 | 150-229 | None |
| R9SMK4 | 1-67 | None |
| A0A7K4A9P8 | 18-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.