DPCstruct | MC7557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 83 ± 2 aa |
| Standard deviation of domain lengths | 2.13 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 77.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 59.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10607 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C7NS82 | 378-457 | ERTMALLAFQDSTDSPVQDLLHSGQRQKTASELNAAILMSQSQEKDPKLPNLLKMLAWSQDQLDERMTYPRIEDWVKADL |
| A0A0E9XBB1 | 1-86 | MERTLALLAFDNPEESPFGDLLNMMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKKVKYPKMTDLSKGTIEDPK |
| I1CQU1 | 63-142 | None |
| A0A822XN00 | 54-137 | None |
| A0A1D6JVD5 | 49-132 | None |
| A0A6A3BND4 | 240-321 | None |
| A0A075ATA2 | 759-840 | None |
| A0A7J9J5U0 | 116-201 | None |
| A0A152A818 | 826-907 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.