DPCstruct | MC7555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 71 ± 3 aa |
| Standard deviation of domain lengths | 3.34 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836APE0 | 909-979 | VPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG |
| A0A7S2FYH8 | 46-117 | TAPTVSIDKTDGCLVYLSRECLDCQFVCAKSSEMNVSWPDEAGDFQEICIPEQFQHKLILDGDTPAISAGVS |
| A0A438MYH7 | 1188-1257 | None |
| A0A1A9XYS8 | 530-599 | None |
| A0A2U3DQA0 | 689-762 | None |
| R7QP74 | 297-363 | None |
| A0A6J5VS59 | 749-820 | None |
| U6KUB0 | 91-162 | None |
| A0A5J4VT16 | 474-549 | None |
| A0A4Y9Y8B4 | 560-633 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.