DPCstruct | MC7554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 126 ± 25 aa |
| Standard deviation of domain lengths | 24.62 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10377 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E9X4L0 | 23-150 | RTLHMKEEENKRLSQRLMSQSMSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVGPTLYFLHSESLTALDLKPASGAARRP… |
| A0A7S2FXY4 | 138-240 | SDMMISWRKFSLNDIVLFLPLPKKTETSPNRAYLAFHEGCPHHYLSAESTEWFRKANKNSYPHYIVGKIILVDELEAGPIGNLTSNP… |
| A0A498N2E0 | 6-111 | None |
| C9SMQ2 | 30-174 | None |
| A0A0G4MAA9 | 499-649 | None |
| A0A2H9TM78 | 207-323 | None |
| A0A4Q9M785 | 471-584 | None |
| A0A397SFL7 | 72-250 | None |
| A0A7R9UFA6 | 156-294 | None |
| A0A2I1E879 | 14-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.