DPCstruct | MC7553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 76 ± 8 aa |
| Standard deviation of domain lengths | 8.01 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G2KUC6 | 1531-1608 | RNILWQTGEIFKEHPITSKLVRVKGTIEDGEVFTEYGNLKIPVRPAFLGGVRSGYSTEVVSFYIGFAMDGPLAYDIQY |
| A0A1V4KVV2 | 41-118 | DEKRMKWLHGTVWNIAKIRDILKRVSGWTKDRNLFIRGHVKEFPILPLHRDSVPPGNENVTFYLGFSFNGLVAFNIEV |
| A0A7J6CT50 | 108-168 | None |
| A0A6G0HJM1 | 208-282 | None |
| A0A3B4A8L3 | 750-832 | None |
| A0A498NQ97 | 433-490 | None |
| A0A498NLQ5 | 55-114 | None |
| A0A498NF68 | 251-329 | None |
| A0A3B4BY95 | 901-977 | None |
| A0A060ZE41 | 184-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.