DPCstruct | MC7552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 165 ± 19 aa |
| Standard deviation of domain lengths | 19.20 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 39.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04987 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A094BKZ6 | 45-195 | AALLPPSLAATPYRSLSLPDLRVSLFFLALLQSAFFSTGNIASISSFSLVSVYRLLPVFDPFSQGALLLLKLLIPFALISANLGVLN… |
| A0A0E9X309 | 23-190 | STKLELSRIDFSENIDITKIRQLSLDDIRRSYFFVFFIITAFFGTGNIASINSFDPASVYCFLTVFNPFIMGALMMWKVLIPFVIVM… |
| A0A034W5B2 | 20-181 | None |
| A0A182T901 | 2-127 | None |
| A0A0U5FSR1 | 47-222 | None |
| A0A6J2JKV5 | 30-227 | None |
| A0A0R3T859 | 274-459 | None |
| A0A5K1K363 | 90-263 | None |
| A0A1V2LTA0 | 9-154 | None |
| M0ZIB9 | 536-689 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.