DPCstruct | MC7551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 215 ± 37 aa |
| Standard deviation of domain lengths | 37.30 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04615 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E9WZJ4 | 25-236 | SEETTIPQPSKKKKRKKNMIDCNEVLTKEAKVIKIPLAPTVIEEEEENEEVQKMIIKEAFAGDDVISDFLKEKRKLEEAGKPKVVDL… |
| A0A7R9VFW6 | 3-159 | QQQLISAAFAGDDVEAAFEAEKAAGVAAELPVVDEPSTLPGWGMWAGSQREPKWMRDAKAAAAEKRAAAAGARKDAGRRNVVISEKW… |
| A0A1J9S617 | 751-973 | None |
| A0A7S4A103 | 25-200 | None |
| R7QEI5 | 540-784 | None |
| A0A1Y1WHM3 | 621-830 | None |
| A0A6L5CFE1 | 454-653 | None |
| A0A7R9H9B6 | 93-331 | None |
| T1HB16 | 528-722 | None |
| D8RPZ1 | 1-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.