DPCstruct | MC755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 91 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.97 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 56.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q4YT70 | 12-86 | VPEGPEDLAAPAPLGLVRTPTGHAGVDARLERLADADHLTADGHVEVYEDVHGGLRDALTALDAPPVPGPYENRS |
| A0A6B1N9L8 | 1-80 | MPEPAYDPAAPAPLNLPRTPTGDAGVDARLARLADADHLATDGHVEVYEDVHRGLRDALTALDGRPGPPVPSPSYEQSRS |
| A0A4D4M4H7 | 14-97 | None |
| A0A1C6QTN0 | 52-135 | None |
| S3B9Y4 | 106-198 | None |
| A0A1W7D382 | 9-105 | None |
| A0A327ULI5 | 92-195 | None |
| A0A367HH96 | 1-92 | None |
| A0A3Q8UNG9 | 62-150 | None |
| A0A2M9AVA3 | 80-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.