DPCstruct | MC7549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 135 ± 16 aa |
| Standard deviation of domain lengths | 15.55 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 24.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03885 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E5NC16 | 24-155 | SMASSMKVAVSSSPFATMLEEEKEIKRYSYELDELKRQIYDAGNMLEKSANIKDFQKFRDLIRSLTDKLVKDAYRIRIVSSYMRRGR… |
| U2LI62 | 41-175 | FSAMLKKNEEANELASAGLPSEIAGMSVEDAVVFLKDRVTTAGDKLIDSMTEDAFAEYRRAVSQFMKYVVKYSFEIEELSGRRNRRT… |
| A0A1I3MRY6 | 34-196 | None |
| A0A7C6QEL9 | 20-152 | None |
| A0A6N2E2K5 | 39-195 | None |
| F8EWQ1 | 25-171 | None |
| A0A4R7TLW8 | 57-188 | None |
| A0A1I6TIX2 | 17-146 | None |
| A0A7Y3NGE7 | 6-123 | None |
| A0A061N7Q7 | 3-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.