DPCstruct | MC7547
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 183 ± 25 aa |
| Standard deviation of domain lengths | 24.83 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 45.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U7XGK2 | 132-301 | KNQIELKEPIIRLHYKSDRFQKDNLPIYNLLINNEKKEQNKALNEFNIDLKDLKDIEDINILNQFKQDFSKDYEFKELNLSFDTNLI… |
| A0A5L4QLH4 | 13-199 | LAKQNKNQTKLKEPIIRLHYKSDRFQKDNLPIYNLLINNEKKEQNKALSELNIDQKDLKDIKNVNILNQFKQDFSKDYEFKELNFSF… |
| A0A5T0RXN0 | 161-301 | None |
| A0A508ZMB3 | 77-217 | None |
| A0A4V7IEX7 | 267-450 | None |
| A0A4V7IEH3 | 449-617 | None |
| A0A1Q2LGJ3 | 1-172 | None |
| A0A7M1CZ84 | 451-626 | None |
| A0A7S9NKE4 | 1007-1165 | None |
| A0A2A4L843 | 173-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.