DPCstruct | MC7545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 113 ± 10 aa |
| Standard deviation of domain lengths | 10.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H9ICR7 | 12-124 | MQEERLDSIEGLEQFLAGTAGVSPRVAGGESERQAHVRRVLGRFGYAGLSHRDKGVAVRYLQHTSGYSRQHLVRLIGRFVAHAPLGQ… |
| A0A450X319 | 1-118 | MNDTRIKTLEQVRGFLAGTSGVELSISSKEECYRWIEQILIRLGYRNCGKAEKGLLLDSIEKVSGYSRIQVKRLVKQYIKTGRIERR… |
| A0A450U4D7 | 6-117 | None |
| A0A7X4ACQ4 | 4-124 | None |
| A0A179BKQ2 | 1-121 | None |
| A0A1F7BNA1 | 1-124 | None |
| A0A7X2PK29 | 17-139 | None |
| A0A1G0FXR3 | 2-117 | None |
| A0A6N8VTD2 | 1-98 | None |
| A0A0G0E963 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.