DPCstruct | MC7541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 344 |
|---|---|
| Mean domain length (aa) | 105 ± 20 aa |
| Standard deviation of domain lengths | 19.58 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 15.69 |
| Pfam Score | 83.70 |
| Assigned Pfam label(s) | CL0421- CL0320- PF14504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1ZT39 | 4-104 | LLMFIIYGFFISCSSGSKATSMDDFSMITIGMSKDELIQQMGKPFSIKKLGDNQEEYIYIERITANKRTIIERKYLFILQNDQVTSK… |
| A0A6B4XL98 | 59-133 | QKPSANITMDLYNQIQNGMTYDQVKGILGEGELTSETKIMDSTAKLYSYISKDGSNANFTFTNDSMDLKAQFNLK |
| A0A382RPK6 | 6-129 | None |
| A0A0G0MFQ5 | 4-95 | None |
| E0NRL0 | 307-398 | None |
| K2DQI9 | 6-129 | None |
| A0A2N6FIQ3 | 22-133 | None |
| A0A413LK38 | 1-107 | None |
| A0A5B8CW98 | 29-145 | None |
| A0A1I1I420 | 5-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.