DPCstruct | MC7540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 71 ± 9 aa |
| Standard deviation of domain lengths | 8.90 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 28.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1ZEJ5 | 1-64 | MNKIYILAHKHPFDDGHIDEKLIGSFFTKKKALQILDDYKNLEGFRDHLDGFYIQEVEIDGLNE |
| A0A4U9JZG5 | 35-102 | EVFILWHTHIDDRLENGEDFKLIGVYSSIKNAEQAINRTSKLEGFKNNLDGFEISAYKLDSDNWTSGF |
| A0A3E0NUL5 | 2-67 | None |
| A0A7G9FE86 | 1-83 | None |
| A0A1S2I218 | 2-66 | None |
| A0A061A9U1 | 1-62 | None |
| A0A2T6A807 | 5-96 | None |
| A0A379MVI3 | 2-83 | None |
| A0A734MQ59 | 1-63 | None |
| E9S3F3 | 2-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.