DPCstruct | MC754
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 114 ± 10 aa |
| Standard deviation of domain lengths | 9.73 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G1NG78 | 2-115 | KAEPSAAQIRQAIESYVKGIEAKDGAFAIHDELTGATRKLTFVRVHERVGKTGGLYYSCTDMRDTATGELLDLDFDVDAADGQLNVV… |
| A0A2N6GJL5 | 2-97 | LKYISDTVDDEGIFHLRDDKTGEDLALKFVRIHDPVRQIGTDIYFACTDFHVVGEEDKLYDLDFWMNDKTGELKIYQSKVHKEPRWS… |
| A0A357CJN6 | 115-212 | None |
| A0A532D6I0 | 11-123 | None |
| A0A2E7MAY1 | 168-295 | None |
| A0A382CKE8 | 19-133 | None |
| A0A2S6SUF2 | 17-116 | None |
| A0A3M1W6G0 | 73-188 | None |
| A0A1E3VVW3 | 1-115 | None |
| A0A2V5LVI5 | 4-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.