DPCstruct | MC7539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 68 ± 2 aa |
| Standard deviation of domain lengths | 1.98 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 68.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 71.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A398ANG3 | 1-71 | MLLIGGPSGGYRKGGVVRPTVTCREKGPCNVKKLRCPAKCFSSFSLSGKGYGGGGGGGCSMDCKKKCTAYC |
| C4J5G4 | 99-165 | GPAGGYARGGVVAPTVTCSEKGPCYRKKVTCPKKCFSSYSGAGKGYGGGGGGGSCTVDCKVKCTAYC |
| A0A4U6SVI8 | 159-226 | None |
| A0A427A5W1 | 74-139 | None |
| A0A6A6LSH4 | 447-514 | None |
| A0A7C8Z111 | 40-107 | None |
| A0A7J9HM82 | 1-64 | None |
| A0A6P5FAG8 | 70-137 | None |
| F4JJL6 | 31-98 | None |
| A0A427AIS4 | 216-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.