DPCstruct | MC7538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 229 ± 33 aa |
| Standard deviation of domain lengths | 33.02 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A518K952 | 1-210 | MSATQWRRIERQSIAIAVTVLALAVTGCTHTHLRKSNVAQVGSITDLLYEQTLSNVAMAHCQPGSLPHVAVISSGTTQATSSAGSTV… |
| A0A2V3QNA6 | 3-230 | KAERITSSDMKHTYRYLLWLLLPCLLPVLQGCLSPITLQHAVSAYDDTITDAISRQLLTNIARAQHHQPIHFTGISNVAATFDFRFN… |
| A0A3L7VSZ4 | 41-311 | None |
| A0A445N1M3 | 2-195 | None |
| A0A142XC53 | 1-248 | None |
| A0A0D6EWC3 | 7-222 | None |
| A0A7W2YJR8 | 2-238 | None |
| A0A1F4E014 | 2-281 | None |
| A0A1N6KPC8 | 1-287 | None |
| A0A4P5XLM1 | 4-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.