DPCstruct | MC7537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 707 ± 66 aa |
| Standard deviation of domain lengths | 66.25 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.75 |
| Pfam Score | 90.28 |
| Assigned Pfam label(s) | CL0475- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9UWZ8 | 2-581 | DSQAFKAANILAGNPPETEGLEIVVLPGAGCKFTFHVPCVVAITGKSVTVKVNREEVPMWARLIIPAKGSLEISGGGGNPGFRVYLA… |
| A0A2V3QIR7 | 1-775 | MSDKTLSTSKAAKPVIEVVTPGIQTTIQDYPGRRGYWNIGVPPSGPMDSLAFRLANRLVGNEEGQAAIEITFSGPTLRIHYDSVIAV… |
| A0A538CYW6 | 2-665 | None |
| A0A817GY31 | 450-1155 | None |
| A0A651GTN0 | 226-884 | None |
| A0A3S5DFF7 | 25-721 | None |
| A0A2P9HYH8 | 83-824 | None |
| M2QVK2 | 4-678 | None |
| A0A1Y0HRF5 | 2-636 | None |
| A5DMJ5 | 309-964 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.