DPCstruct | MC7536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 110 |
|---|---|
| Mean domain length (aa) | 127 ± 18 aa |
| Standard deviation of domain lengths | 18.34 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04448 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M3MHF9 | 6-130 | AAVQAIDRFDEAAKVWGWQENEGYDSAVIAYASEEYRAARKNLEDTIVALSSPAREEWRTIESAPKDGSEFLAWPCSTEKGNIVVKA… |
| A0A540V432 | 10-125 | TFRENGVTRHEALTPEQAEALWLQAEERERHRAELMPDEQSAILMLFEAFQRLKDLGWQEAIYCPKDGTVFDAIQAGITMVADCRYV… |
| A0A090MT26 | 1-129 | None |
| A0A855G7I7 | 120-250 | None |
| A0A1R0G2H2 | 72-221 | None |
| A0A5E4YVH6 | 10-90 | None |
| A0A6P2GYJ4 | 268-387 | None |
| A0A256GFI3 | 126-251 | None |
| G9Y704 | 1-142 | None |
| A0A6I6LW92 | 99-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.