DPCstruct | MC7535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 130 ± 14 aa |
| Standard deviation of domain lengths | 13.90 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T8IG32 | 1-138 | MKTEITPKDIITIVGGGNMTDQYQDIENCRLEWLKNFPNNKIISFPQTIDFTETKDGLKSFQRSKRLYERHRNFHLIGREKKSYDFM… |
| A0A150JXV7 | 79-229 | VKNIIGKDDIVCFTGGGNLGSLYLDIEEDRRKVISAFKNYKTISMPQSVYFEPTEKGQREKRKSQEAYGMNPNLTICARESQSLQIV… |
| A0A3P1Y9A2 | 40-153 | None |
| A0A2X3EAU1 | 1-142 | None |
| A0A1F5EHA3 | 62-171 | None |
| A0A1H6LIH2 | 476-624 | None |
| A0A6H3S9U8 | 70-200 | None |
| A0A155VFD3 | 76-203 | None |
| X0R3E5 | 83-221 | None |
| R9N0L0 | 192-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.