DPCstruct | MC7533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 243 ± 31 aa |
| Standard deviation of domain lengths | 30.92 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18871 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q9NDT1 | 1-226 | MGTMISLALNDIDIDWGKNRRWTNHHWLFPPGSITDVVYTYAGGVTETKPGFTTTLNDAYLRLCHLGYSQTETKDKFERVLGRWNRT… |
| A0A165V8Z0 | 1-299 | MLTEVDLGKNVFCWGKLGKTMGTYIALTVGRLELTSSKNMLGPYHGDLFLDSDRKEVPDPLGNPEEKYPAFQTTVEQILPRIELMGH… |
| A0A3T1D6V4 | 1-246 | None |
| A0A1I2PAX4 | 1-190 | None |
| A0A3N1GBT3 | 44-291 | None |
| Q6LR51 | 1-246 | None |
| A0A2N7XVN9 | 7-249 | None |
| A0A442GAD0 | 1-251 | None |
| A0A502C8Q6 | 1-280 | None |
| A0A7Z7FLC8 | 5-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.