DPCstruct | MC7530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1446 |
|---|---|
| Mean domain length (aa) | 147 ± 30 aa |
| Standard deviation of domain lengths | 30.47 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 16.05 |
| Pfam Score | 77.76 |
| Assigned Pfam label(s) | PF00571- CL0126- CL0436- CL0108- PF00654 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I7XY32 | 1-112 | MVRVPSDATVAAAAAALINAEVGAVIVGAQARPTALISERDVARVVAAGQDPTAVRAADVASTNLVWCAADATVDEVAQRMTDKHIR… |
| A0A7C2P5Y5 | 34-193 | IFQLALEHAKRRLKKRILVKNVMTKNVIAVKKDTKVSELIEILTKNRISGVPVVDEENRVIGIVSEADLLFTTKTGKIRGLRDFLKR… |
| A0A7S4E3L5 | 565-707 | None |
| A0A1G3XVE9 | 83-230 | None |
| A0A1Q9CEE0 | 816-979 | None |
| A0A7C4M0A4 | 307-441 | None |
| A0A1Y6C569 | 1-140 | None |
| A0A1Y6BKI9 | 3-135 | None |
| A0A832M9U8 | 39-185 | None |
| A0A0P9BEF8 | 99-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.