DPCstruct | MC753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 162 ± 12 aa |
| Standard deviation of domain lengths | 11.88 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1XY14 | 1-162 | MNARSGRWMVQRCDRELPVACLSQRNFSDWVIVNKHRYHYVSADRGCPAGYTFSVPKTARENLHLARSLNASGEPLAWIDLNSLSSV… |
| A0A0J8S7U3 | 1-170 | MDLSLSGHWRSSGCSDRLYAACRIRNSPFDWTLSREPEPYTLAGDTCPEGSSFDVPRTALENTYLYKHVLQQSKDLIDPSSEETEKT… |
| U1GTG2 | 505-675 | None |
| Q75AQ7 | 286-450 | None |
| A0A0L0SW50 | 126-283 | None |
| F4P344 | 46-206 | None |
| A0A421JBA3 | 398-580 | None |
| A0A507E4U5 | 392-558 | None |
| A0A1S8B4A1 | 463-601 | None |
| A0A642VA52 | 335-483 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.