DPCstruct | MC7529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 147 ± 10 aa |
| Standard deviation of domain lengths | 10.25 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A261XSQ6 | 3-146 | TNTMQSTTALGLVRSGVCLQFLGLFWGIVVPLTPYPRIGLAAHIQFMGSGAMVLLAGILLHQPSIIELGSVQSRIVYWGFATVWFVI… |
| A0A1Q5SL57 | 1-151 | MDLQQILSRQGRRLLQLGVVLFLFTSFEGFVIPALASPHLGRSVHTLSGFTGVLFLATGLMWPTLKLGTTATRIAFWFLIYSALATI… |
| A0A6G1GT85 | 75-241 | None |
| A0A2V9LIR7 | 12-161 | None |
| A0A1V3PDV7 | 2-128 | None |
| A0A518GB85 | 41-190 | None |
| A0A0C3A6Y2 | 3-137 | None |
| A0A813LAM4 | 35-181 | None |
| A0A813PBP6 | 2-144 | None |
| A0A0D2EXM3 | 1-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.