DPCstruct | MC7528
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 69 ± 7 aa |
| Standard deviation of domain lengths | 6.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 32.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A352NQW7 | 1-59 | MPAEELYEVRQVEVELPPLARVFDTLICAECGEPVMEPRARLQEGRVVCLPCAGQYSRG |
| A0A645J050 | 5-68 | EKQEYLLNSSAEDLFEYKKPHYSLPQKAKIFQTIICENCGEGASDHKIRFMDGKKVCLDCFEEY |
| A0A1G1G1B5 | 2-64 | None |
| A0A489FZ43 | 38-109 | None |
| A0A0F7IEJ6 | 41-113 | None |
| A0A7J4ENS2 | 42-102 | None |
| A0A7C3XSZ1 | 32-101 | None |
| A0A0E3KSI4 | 101-166 | None |
| A0A444JDL4 | 175-245 | None |
| A0A7J4EEW5 | 33-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.