DPCstruct | MC7526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 138 ± 14 aa |
| Standard deviation of domain lengths | 13.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5ETW5 | 4-132 | RIREHTRESINKRIDRQTLGAVADSIGSTDEISIRLRELDREWHVDRALMLNFAVLGGLSGGMAMRNLARRGRIGGWGLFFWVQVGF… |
| A0A838SE28 | 1-146 | MAIPSTNIRVEEHTDDRINEEIYQRSKHHVAVYAAAGSAAIDRRLKELDQEWDIERVLEANAASISLIGLGLGALYHRRWFLLQAAV… |
| Q090G6 | 695-835 | None |
| A0A7W1DQG5 | 3-132 | None |
| A0A4V0HVN3 | 9-146 | None |
| A0A818CT15 | 3-139 | None |
| A0A817SW76 | 35-176 | None |
| L8H2Z6 | 42-179 | None |
| A0A5C1ACJ8 | 10-124 | None |
| A0A383VK46 | 17-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.