DPCstruct | MC7525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 138 ± 18 aa |
| Standard deviation of domain lengths | 18.05 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4E2F7 | 2-127 | FAADGAAAARLIPKIRKGIKAYPYDERGDYRLWPGPNSNTFVAAVLAAVPEIHTALPPTALGKDFPHDGRWIGLTPSRTGFRFSLGG… |
| A0A7Z9V6M3 | 12-135 | VDLRGQAAEEAIVNIADAISEYSYPWGYRLWPGPNSNTFTAFVGRRVPALRLHLPPTAIGKDFIENGDVLAHTPSGTGYQISLAGLL… |
| A0A1S7PYU3 | 46-184 | None |
| A0A2N8HC36 | 97-234 | None |
| A0A7Y5UT93 | 49-224 | None |
| A0A2H0QIL2 | 71-209 | None |
| A0A139TP17 | 37-174 | None |
| A0A3B1AFW7 | 34-168 | None |
| A0A800BEA8 | 165-285 | None |
| A0A6P1S4T7 | 80-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.