DPCstruct | MC7524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 146 ± 13 aa |
| Standard deviation of domain lengths | 12.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7S884 | 1-153 | MTPCPYIPEVAGDLSAQTFSDIWRGSALFRRLRGGGPLGGKCGTCEYRKLCGGCRARALAVSGDLLAADPSCAYEVQDVAYGDEFAP… |
| A0A7Z9GLQ0 | 1-139 | PKGSGRSHLLRDRSLLGGRCGECEFRDVCGGCRARAYAINDDYLAEDPSCTYQPGQYGGEMIQFPHVTAFGSEPAYELTWTQTAQER… |
| A0A1F4DTV0 | 1-121 | None |
| A0A7X4CRJ6 | 475-636 | None |
| A0A7K2C721 | 19-168 | None |
| A0A7C5KNQ0 | 105-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.