DPCstruct | MC7523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 185 ± 19 aa |
| Standard deviation of domain lengths | 18.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537BVV6 | 2-154 | RIERIESGAPDNAHPYGISVDAMRQKLASVKLRGDPIFTSEELDELAPYLAAALKSVGPNEDVTFALTGSHGLLGKFSPKTVTTGRV… |
| A0A7W1Z111 | 34-238 | THTVFETPTRYVRLAVDQTVSLKSKFSHPVAIPPDNMNALLAGLIVVEPVSLIPWPFQEERPSRHPLFSEEDIRFWSPLLTKALDVA… |
| A0A525WN40 | 1-176 | None |
| A0A532DQ42 | 17-202 | None |
| A0A532DTI9 | 1-132 | None |
| A0A1W9GHT1 | 34-230 | None |
| S3W8B2 | 7-199 | None |
| A0A849MLD4 | 33-234 | None |
| I3CL04 | 31-209 | None |
| A0A533Y9Z6 | 23-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.