DPCstruct | MC7521
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 130 ± 9 aa |
| Standard deviation of domain lengths | 8.84 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W5FHE5 | 6-128 | KRICVLVLAVVAIVVGVWAAAFPLSFHHDFPAPGWGWVSRLGPYNEHLVRDVGGLYLALAVLSVLAFRRPTFALLRVTGGAWLIFNV… |
| A0A2T6KUL1 | 18-147 | SRTQYAALGATVIIVGVVGVWSYFWPQAYYDHFPVFLGEWVSKDGPYNEHLVRDHGAMYLGLGAATLYGLVRPAQVGCRVLGIAWTL… |
| G8SBL0 | 53-182 | None |
| A0A7W1LSU0 | 9-142 | None |
| A0A1G7MEG2 | 3-135 | None |
| A0A0B8N100 | 24-156 | None |
| A0A538B073 | 457-593 | None |
| A0A7V9HFL5 | 2-122 | None |
| A0A7K1IAX5 | 8-140 | None |
| A0A1H3JM81 | 6-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.