DPCstruct | MC7520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 83 ± 3 aa |
| Standard deviation of domain lengths | 3.39 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 85.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L7Q2K7 | 210-290 | RNKLHHIFGNHRHRLADIVTAAGSEEAAFDAMERGAQAAFGVGGLKEIRPGVFEGAVTIFGTEVTVRGVVVGGVFRVGSAW |
| A0A2B8A156 | 1-89 | MPLNRLNHIFGKPEHALESLVTKFGSQEGAYNAVQNAANQALKAGKLTPSPKGILPSGDLGNIINVGGMNVRLIGGRVENGQVILSS… |
| A0A0A8GVS5 | 211-292 | None |
| A0A844CQD3 | 197-279 | None |
| A0A4V1B8A0 | 171-252 | None |
| A0A841I6D6 | 53-140 | None |
| A0A1I0SEE7 | 1-77 | None |
| A0A7I9V7Z1 | 464-547 | None |
| A0A379CV52 | 101-183 | None |
| A0A7C2YL11 | 135-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.