DPCstruct | MC752
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 102 ± 10 aa |
| Standard deviation of domain lengths | 9.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 26.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177A8A5 | 127-220 | NVEVAFTMSTELTNLIFSTITPNQTEFILPHDSTQYQILDSFEDMAKASSNKLKRFQYTCFVRKERVVLLWHDDVESILSHGDKVER… |
| A0A6H0XZT2 | 54-154 | NVKTAMTVNTRVIKLFLQDNDRPYVPLGNGLRLQVLSDISSLPRCQKHHFAAFIADRAILVVWDDEPRHLLDRVKSILDALMRVVWD… |
| A0A395J675 | 39-143 | None |
| A0A2T3A9H1 | 1-112 | None |
| A0A1Y2C8E9 | 133-244 | None |
| A0A4Y7Q7I6 | 65-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.